PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_081830_goqc.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 435aa    MW: 47155.2 Da    PI: 6.9657
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_081830_goqc.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.3e-16230284357
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         ++kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN++L k+l  ++++  
  Bv4_081830_goqc.t1 230 DVKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKFN 284
                         689*****************************************99988877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-12227284No hitNo description
SMARTSM003381.5E-19228292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634230285IPR004827Basic-leucine zipper domain
PfamPF001701.2E-13231281IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-11232281No hitNo description
CDDcd147024.57E-6233284No hitNo description
PROSITE patternPS000360235250IPR004827Basic-leucine zipper domain
PfamPF124987.2E-39299424IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MDRVFSVSDI SDQFWSPPPP GPVTGDPKMN RSASEWAFER FIQETSPLSD SSSSKSLAEN  60
DVVEVNRHHH HHTTTMNNNS NDITSNYYSK NDDGNNNCSS QSPPTKAKTG SFHSQGSSVL  120
VDSEDYHAIL KSKLNLACAA VALTRAPFVI NQNSAGAAES ATQGTADSQP VSVLPCKGSQ  180
DKDAKPIGIP ALPAMPKKPV TQAKQTTSYS SGQSDDDDLE GENDGNDPAD VKRVRRMLSN  240
RESARRSRRR KQAHLTELET QVSQLRVENS SLLKRLTDIS QKFNEAAVDN RVLKADVETL  300
RAKVKMAEET VKRVTGMNPL LQAMSEISAM GMSPFGGSPS DSADAAVPVQ EEPKQPHFYQ  360
PVDNNPLPGP NPRVNSGVTD IPTIDNVLHN AATQVLNGSK MGRTASMQRV ASLEHLQKRI  420
RGRVDQGSPH GGAEQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244251RRSRRRKQ
2246251SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674829.10.0PREDICTED: light-inducible protein CPRF2
SwissprotQ990901e-102CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A0J8FCN50.0A0A0J8FCN5_BETVU; Uncharacterized protein
STRINGVIT_14s0030g02200.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.22e-67bZIP family protein